PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G213700.1.p
Common NamePRUPE_ppa022966mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 124aa    MW: 13964.7 Da    PI: 6.0947
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G213700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.91.1e-1071100130
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                         ++ +hn+ Er RR+++Ns ++ Lr+llP +
  Prupe.1G213700.1.p  71 KKLNHNASERDRRKKMNSLYSSLRSLLPVD 100
                         6789************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.13170119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.3E-870106IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.4E-871100IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.47E-971110IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MLALSPPLFS TIAWPSEDLL SRDQNYFYRD SSIDQSAESF LHILPSHQPH VDLDRSTTIG  60
GDYSGVSTMT KKLNHNASER DRRKKMNSLY SSLRSLLPVD QGVEKADRLE CENLSEKLMS  120
IYA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226383.13e-87hypothetical protein PRUPE_ppa022966mg
TrEMBLM5XN954e-87M5XN95_PRUPE; Uncharacterized protein
STRINGVIT_13s0047g00450.t011e-28(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56980.12e-16bHLH family protein